SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q47TQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q47TQ4
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-31
Family Anti-sigma factor antagonist SpoIIaa 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q47TQ4
Sequence length 117
Comment (tr|Q47TQ4|Q47TQ4_THEFY) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=269800 OS=Thermobifida fusca (strain YX). GN=Tfu_0122 OC=Thermobifida.
Sequence
MDLKLDHHTQDDTEVVVVEGEIDVYTAPRLRELLIDLVNKGHHHLIVNMEKVEFLDSTGL
GVLVGGLKRVRAHDGTLDLVCTQERILKIFRITGLTKVFGIYESVQEAIDKRKSKQS
Download sequence
Identical sequences Q47TQ4
WP_011290569.1.72373 WP_011290569.1.82272 269800.Tfu_0122 gi|72160526|ref|YP_288183.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]