SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q47X03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q47X03
Domain Number 1 Region: 3-290,473-531
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.4e-89
Family FAD-linked reductases, N-terminal domain 0.0000715
Further Details:      
 
Domain Number 2 Region: 292-474
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.37e-61
Family GMC oxidoreductases 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q47X03
Sequence length 561
Comment (tr|Q47X03|Q47X03_COLP3) Choline dehydrogenase {ECO:0000256|RuleBase:RU003969} KW=Complete proteome; Reference proteome OX=167879 OS=psychroerythus). GN=CPS_4010 OC=Colwelliaceae; Colwellia.
Sequence
MKTHLYDYIIVGAGSAGCVLANRLSEDGNSNVLLLETGGSDKSIFIQMPTALSIPMNSSK
YAWQFETEPEPFIDNRRMHCPRGKVLGGSSSINGMVYVRGHARDFDEWQQYGADNWDYAH
CLPYFKKAETWAFGGDEYRGNDGPLGVNNGNKMANPLYKAFVNAGVDAGYFSTDDYNGSQ
QEGFGAMHMTVKDGVRCSTANAYLRPAMTRKNLTVITHALVHKVLLENKTAVGIRYERKG
QVLDVKVNKEVILSAGSIGSPHLLQLSGIGAKNVLTEAGIETLHDLPGVGQNLQDHLEFY
FQFKCNQPISLNGKLGLWNKFLIGTRWILNKDGLGATNHFESCGFIRSKANVEWPDLQYH
FLPAAMRYDGKEAFAGDGFQVHVGHNKPKSRGSVNVASNDPKAPPKISFNYLEHEEDRAG
FRACVRLTREIIHQPALDEYRGEEIQPGAHIQTDEEIDAFVRSAVESAYHPSCSCKMGVD
DLAVVDPQTRVRGIKGLRVVDSSIFPTIPNGNLNAPTIMVAERAADLIRGLDTLAPSNEK
VDITPNWQQQQRPREATRNIK
Download sequence
Identical sequences Q47X03
167879.CPS_4010 WP_011044754.1.15195 gi|71278669|ref|YP_270668.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]