SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q483I1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q483I1
Domain Number 1 Region: 251-775
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 3.01e-194
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000197
Further Details:      
 
Domain Number 2 Region: 789-933
Classification Level Classification E-value
Superfamily ADC-like 3.39e-39
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.0016
Further Details:      
 
Domain Number 3 Region: 108-246
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.53e-38
Family Ferredoxin domains from multidomain proteins 0.0086
Further Details:      
 
Domain Number 4 Region: 33-105
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.85e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q483I1
Sequence length 967
Comment (tr|Q483I1|Q483I1_COLP3) Formate dehydrogenase, alpha subunit {ECO:0000313|EMBL:AAZ25205.1} KW=Complete proteome; Reference proteome OX=167879 OS=psychroerythus). GN=CPS_2058 OC=Colwelliaceae; Colwellia.
Sequence
MVDIYDPKAAQNQSTRSQNIIDFGTPEVYSDVQVTLTIDGQEISVPKGTSVLRAAAMLNI
TIPKLCASDNLESFGSCRLCAVEIEGRRGMPASCTTPVEHDMQVSTQNKKIARLRKNIME
LYISDHPLDCLTCPSNGDCELQDMAGAVGLREVRYGFDGENHLDVAKDTSNPYFTFEPSK
CIVCSRCVRACEEVQGTFALTIDGRGFDSKVSTGLDNDFLSSDCVSCGACVQACPTSTLM
EKSVIDQGQPEHSVTTTCAYCGVGCSFEAHMKGEEVIRMVPAKDGQANHGHSCVKGRFAF
GYATHQDRITSPMVRDSIDQPWQEVSWDEAISFAAKRLKEIQKKHGKDSIGGITSSRCTN
EETYLVQKLIRAAFGNNNTDTCARVCHSPTGYGLKATLGESAGTQTFDSVMEADTIIVIG
ANPTDAHPVFGSLLKKRLRQGAHLIIADPRKIDLGNSPHVKLDHHLPLRPGTNVAFINAM
AHVIVNEGLEDKAFIAERCETQAYQQWYSFISDVRHSPENTETITGVDADQLRQAARLYA
KVDNGAIYYGLGVTEHSQGSSMVMGIANLALLTGNIGREGVGVNPLRGQNNVQGSCDMGS
FPHELPGYQHVSNDALRSKFEQHWQVDIDNEPGLRIPNMFDAAIDGSFKGMYCQGEDIAQ
SDPNTHHVEAALTSLECLIVQDIFLNETAKFAHVFLPGSSFLEKDGTFTNAERRINRVRK
VMAPLAEKADWQATMALSNALGYPMNYQHPSEIMDEIAQLTPTFSGVSYQKLDELGSIQW
PCNDSNPLGTPTMHIDDFPIGKATFALTEYVATDERASRKFPLLLTTGRILSQYNVGAQT
RRTENQVWHDKDQLEIHPHDAQERGIQGGDSLGISSRAGNTVLTAKITERMQPGVVYTTF
HHPESGANVVTTDNSDWATNCPEYKVTAVQVEKVSSPSNWQLRNKEFSIKQNEFLPKKRS
DEARVKL
Download sequence
Identical sequences Q483I1
gi|71278992|ref|YP_268786.1| 167879.CPS_2058 WP_011042880.1.15195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]