SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q485S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q485S6
Domain Number 1 Region: 15-66,127-277,369-426
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.17e-41
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 
Domain Number 2 Region: 279-369
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000392
Family D-aminoacid oxidase-like 0.03
Further Details:      
 
Weak hits

Sequence:  Q485S6
Domain Number - Region: 84-144
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0249
Family CRAL/TRIO domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q485S6
Sequence length 427
Comment (tr|Q485S6|Q485S6_COLP3) Putative D-amino acid dehydrogenase, small subunit {ECO:0000313|EMBL:AAZ26758.1} KW=Complete proteome; Reference proteome OX=167879 OS=psychroerythus). GN=CPS_1447 OC=Colwelliaceae; Colwellia.
Sequence
MSTVVDQEGNNKQQTVAVIGAGIIGINCALELQSLGYQVTLLDKEGIGLGCSKANAGHFA
TEQVFPLAEFSLLWQMPKLLFDPLGPVALSAKHFIKAIPWFMQFFNNMRPTLRNKNKKAL
QALNKNAIHHYTALLKAAEAEHLISLDGSLLVFETNDRTKVELMYQHYLAAGIAVKLLDK
RQTLELEPNLSNNINYSLYFTDVAHTIDPLALSKTLAEFAMCKGMTFQQTAVTSVTQTQS
GVTVEIDEQHLHVDHCVIACGAWSKKLLNGLNYHLPIEAERGYSLSLPISAAASALLSRP
VASAERRFIITPMGKTLRLAGTVEYAGLNAPANYKRAEMLKGNAAYILKRLPENEEKQEA
WMGCRPSLPDSLPVICQAPNHDKIFFALGHQHLGLTQGAITGKLIGQLVTGHSPEINIDP
FCIRRFN
Download sequence
Identical sequences Q485S6
167879.CPS_1447 gi|71280545|ref|YP_268189.1| WP_011042283.1.15195 CsR152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]