SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q48HH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q48HH1
Domain Number 1 Region: 348-434
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000922
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q48HH1
Sequence length 442
Comment (tr|Q48HH1|Q48HH1_PSE14) Sulfate permease family protein {ECO:0000313|EMBL:AAZ33513.1} KW=Complete proteome OX=264730 OS=(Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6)). GN=PSPPH_2981 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MVIAFVGGRPAMISAATGAMALLMVNLVKEHGLQYLLAATLLCGVLQIIAGYLRLGELMR
FVSRSVVTGFVNALAILIFMAQLPELTHATWPVYAMTAAGLAIIYLFPRVPLLGKLLPSP
LVCILLLTAMSIYMGLDVRTVGDMGAMPDSLPVFMWPDVALNLDTLLIILPYSAALAVVG
LLESMMTATIVDDLTDTTSDRNRECRGQGIANIASGLIGGMAGCAMIGQSMINVKSGGRT
RLSTLSAGLLLLIMMLFLGDWLARIPMAALVAVMIMVSISTFSWESIRNLKQYPLSTNIV
MVVTVIMVVATHNLAYGVLVGSLLAAMFFASKIARYLDVTSQRDPEHSHRTYYVTGQVFF
ASAERFMASFDLRENVETLAIDLREAHFWDITAVAALDKVVLKLRRAGISVDVVGMNRAT
ATLVDRFGVHDKPDAIDSLMGH
Download sequence
Identical sequences A0A0N0F812 A0A0N0FXY7 A0A0N8SEV0 Q48HH1
264730.PSPPH_2981 gi|71733749|ref|YP_275162.1| APC65034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]