SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4A8S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4A8S9
Domain Number 1 Region: 70-326
Classification Level Classification E-value
Superfamily Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 1.96e-78
Family Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 0.000000276
Further Details:      
 
Domain Number 2 Region: 329-425
Classification Level Classification E-value
Superfamily Pyrimidine nucleoside phosphorylase C-terminal domain 3.4e-21
Family Pyrimidine nucleoside phosphorylase C-terminal domain 0.0024
Further Details:      
 
Domain Number 3 Region: 1-69
Classification Level Classification E-value
Superfamily Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain 5.23e-18
Family Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4A8S9
Sequence length 427
Comment (tr|Q4A8S9|Q4A8S9_MYCH7) Thymidine phosphorylase {ECO:0000313|EMBL:AAZ53460.1} KW=Complete proteome OX=262722 OS=Mycoplasma hyopneumoniae (strain 7448). GN=MHP7448_0083 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MSLFEIIEKKSQKHKLSAEEINFMINGFQSGLITDYQFSAFLMAILINGLDDDELFYFTR
EIIASGNTINLSKINGIKIDKHSTGGVGDKISLIIGPIFASLGYKVAKMSGRGLGFTGGT
IDKLESIPGFKTQLTEANFLEQVQKIGLAIVAQSNALVPADKKIYALRDVTGTVSSIPLI
ASSIMSKKIATGADVILIDVKCGNGAFMTELPKAKKLASKIKMLGKKFGKKTIVKITNME
APLGKMIGNKNEIIESLSILQGNQSQLSEFASELVAQTLTELEKIKIEKARKKVKDVIES
GQAYELFLKMVSAQGGNLTLIQSSNFWIPAYKEQIFAPQNGYIKWENALIFGKIVAFLGG
GRTKLNQKIDYEAGISLEVETGEYVQEDQLIFSLYSSSPIDLRQIQDLIPKTFSINPEPE
FEKMFLN
Download sequence
Identical sequences E4QS88 Q4A8S9 Q601A4
262722.MHP7448_0083 295358.mhp298 WP_011206135.1.100269 WP_011206135.1.28423 WP_011206135.1.29754 WP_011206135.1.35737 WP_011206135.1.4867 WP_011206135.1.51147 gi|54020133|ref|YP_115811.1| gi|385334240|ref|YP_005888187.1| gi|72080425|ref|YP_287483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]