SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4FZZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4FZZ7
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily Histone-fold 2.84e-48
Family Nucleosome core histones 0.0000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4FZZ7
Sequence length 128
Comment (tr|Q4FZZ7|Q4FZZ7_DANRE) Histone H2A {ECO:0000256|RuleBase:RU003767} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=zgc:114037 OC=Cyprinidae; Danio.
Sequence
MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TEKAAKGK
Download sequence
Identical sequences Q4FZZ7
7955.ENSDARP00000067895 7955.ENSDARP00000100344 7955.ENSDARP00000100642 ENSDARP00000067895 ENSDARP00000104918 ENSDARP00000106877 ENSDARP00000108417 ENSDARP00000112301 ENSDARP00000123619 NP_001026996.1.45394 XP_005163253.1.45394 XP_005168861.1.45394 XP_009301165.1.45394 XP_009301166.1.45394 XP_009301180.1.45394 XP_017209638.1.45394 ENSDARP00000067895 ENSDARP00000104918 ENSDARP00000106877 ENSDARP00000108417 ENSDARP00000112301 ENSDARP00000123619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]