SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4J6E4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4J6E4
Domain Number 1 Region: 376-451
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000145
Family Carboxypeptidase regulatory domain 0.026
Further Details:      
 
Weak hits

Sequence:  Q4J6E4
Domain Number - Region: 457-548
Classification Level Classification E-value
Superfamily E set domains 0.000407
Family Filamin repeat (rod domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4J6E4
Sequence length 646
Comment (tr|Q4J6E4|Q4J6E4_SULAC) Conserved protein {ECO:0000313|EMBL:AAY81637.1} KW=Complete proteome; Reference proteome OX=330779 OS=NBRC 15157 / NCIMB 11770). GN=Saci_2356 OC=Sulfolobus.
Sequence
MKTVKSVSIVGLILLSLCLNTFLFTSQTTAGNQTTNSNAGVYIAPNNLLNPLASSPPTIP
VFTTTNQATFTFYVINSRSTQATIPVYVDSSLYTTLTLPPYSYKPISLQLSTGLHTISAN
SETVNVNVTTVQNAINGIMYLNGTPTLITINANPGKVYSLFYSYSPQVQNLSLISQGFIT
NLANNYWETSYVFPSPGNKLLIIVPQNISQGLYYAYYYSVFAGFVNGTEIPNSYVYGIVL
INVSYGIPSSLPSPVKYFGQGGISAFVENISGNTYLQINYPFSFQNVYNVTVLTNGKEQT
YILTNTSGGNYVILGTPYSPSVYGTNTQWSYSNSSIMLKLPQFSSGIVKVTGPYGNAVVN
LSESSKISLVTTTLKVVSVNGSPIQGATIDVYNMTTKSLITTLQTNSTGLTALQLPQGTQ
VEIYVKANGYLSNSTVLNVTQQGELTIYLKPIVVSITPSVVLVNGTQTSLVLTKTGYELA
KNITVGSTIEFNFTVKVSGMVMNNVSVTAYINGNMVTVESLGNGNYSVVFKPTNTGTYNL
TLVANYNGVSNRTMIEFYTHQLPVTTGTSTSTSTTTSTTTSTTTSSTSSTTTSSATTTTS
TSTITTTPQSSSTKPSTSSGFPVIPVIIVVIIVIVIVAIILLIRRR
Download sequence
Identical sequences A0A0U2NAI3 Q4J6E4
330779.Saci_2356 gi|70608060|ref|YP_256930.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]