SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4J9S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4J9S1
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily Homeodomain-like 3.97e-17
Family Tetracyclin repressor-like, N-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4J9S1
Sequence length 196
Comment (tr|Q4J9S1|Q4J9S1_SULAC) Transcriptional regulator TetR family {ECO:0000313|EMBL:AAY80459.1} KW=Complete proteome; Reference proteome OX=330779 OS=NBRC 15157 / NCIMB 11770). GN=Saci_1107 OC=Sulfolobus.
Sequence
MMYRAPKTEKGKESLNKILDASVELIADKGFLSTSINDITSKAGVAYGLFYFYFKSKHDI
LDEIIRQFNRNMRYYLKTYTQNLDSRIDVEKVGMKKFLEWMNENKKYYKIFIETQVHRPD
IYKWHFMKLAERYTTGLSEAMRRGEIINVDPELLSYVLIGIAHMLGKRYVLWSNSGLTLK
QQRDLDLIIENMLTPR
Download sequence
Identical sequences Q4J9S1
6el2_A 6el2_B 330779.Saci_1107 gi|70606882|ref|YP_255752.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]