SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4JLK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4JLK9
Domain Number 1 Region: 8-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-79
Family Protein kinases, catalytic subunit 0.00000299
Further Details:      
 
Weak hits

Sequence:  Q4JLK9
Domain Number - Region: 488-548
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00131
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 
Domain Number - Region: 352-400
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0301
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q4JLK9
Sequence length 634
Comment (tr|Q4JLK9|Q4JLK9_LACRE) Lr0988 {ECO:0000313|EMBL:AAY86841.1} OX=1598 OS=Lactobacillus reuteri. GN=lr0988 OC=Lactobacillus.
Sequence
MNPGYEIGHRYRIIRSLGEGGMANVYLAHDMVLDRDVSVKLLRLDLRDDPNTKRRFHREA
MAATQLNDPHIVGIYDVGEDHGLQYMVMQYVKGTDLKAYIKKHYPIPLPQVIDIMEQVLS
AVATAHAHGIIHRDLKPQNILIDENKNVKITDFGIAVAVSQDSLTQTNTLMGSVHYLSPE
QARGSIATKQSDIYSLGIILFELLTRKVPFEGETAVSIALKHFREEIPSVREQNKEIPQA
LENVIIKATAKEPAERYSSVNEMAADLKTVLDPQRANEPRLKIQQDDNGETKVLDIKHLK
ADDYQPKKSTDSPTVDLSTKPQKWKKYGIVSGTLGMIVLIAVCSWWFLIRQVIIPDVEGM
TVLKAEQRLHQQNLRIGKITRVNSQAVDKNRIVSTNPDVSHKTRVSTPINLTVSTGVKQL
QMADYVGEDYSSVAANLRRKGFQVHQEPVYSDDIDKGQIIRQNHKKGTIVKPAANTIIFR
VSAGKEPIKIPNFKNQDISAVQQFANKNNLQLTTQEKKSKTIATNHVINQTPRAGSTLNH
GDTLTVSIANSGNQTKTTNIQINIPFDGNGGQRENRVQVYIRDANHNLTMEYQDITINQE
TTINVPFTLKQGQTGAYRVVRNGRTIMSATNITG
Download sequence
Identical sequences F8DKT2 Q4JLK9
gi|338202532|ref|YP_004648677.1| WP_003672210.1.101197 WP_003672210.1.15271 WP_003672210.1.46412 WP_003672210.1.73577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]