SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4JVI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4JVI0
Domain Number 1 Region: 1-214
Classification Level Classification E-value
Superfamily Formyltransferase 4.32e-52
Family Formyltransferase 0.0000154
Further Details:      
 
Domain Number 2 Region: 213-313
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.53e-27
Family Post formyltransferase domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4JVI0
Sequence length 327
Comment (sp|Q4JVI0|FMT_CORJK) Methionyl-tRNA formyltransferase {ECO:0000255|HAMAP-Rule:MF_00182} KW=Complete proteome; Reference proteome OX=306537 OS=Corynebacterium jeikeium (strain K411). GN=fmt OC=Corynebacterium.
Sequence
MKIVFAGTPEPAAVALEHLIADERIEVVAVVTQPDAKRGRGRSLRPSKVAEVAEEAAIPT
YKWPSLKAGTESGDEARAVLGDLAAQGVTAAAVVAYGNLIPKDILDVFEHGWVNLHYSLL
PRWRGAAPVQAALAAGDETTGASIFRIEEGLDTGPVAAQLTQKIGLEDTADDLLASLTYA
GRELLADTLVAMDEGKAELSGQDDAQATHAPKIHPADAQIDWSQPAEVIQRVARAHTPAP
GAWTLLDGQRYKIGMLLPSDPADVAELGPGEVVASPKKVFVGTGTGPLEITRIQPPGKKM
MEAAAWARGQQELLAGRPTFSARETGE
Download sequence
Identical sequences Q4JVI0
gi|68536090|ref|YP_250795.1| WP_011273585.1.58937 306537.jk1013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]