SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4K9X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4K9X1
Domain Number 1 Region: 117-372
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.93e-66
Family D-glucarate dehydratase-like 0.0000000153
Further Details:      
 
Domain Number 2 Region: 6-130
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.77e-33
Family Enolase N-terminal domain-like 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4K9X1
Sequence length 382
Comment (tr|Q4K9X1|Q4K9X1_PSEF5) Muconate cycloisomerase {ECO:0000313|EMBL:AAY93126.1} KW=Complete proteome; Reference proteome OX=220664 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5). GN=PFL_3862 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MHASAIESIETIIVDLPTIRPHKLAMHTMQNQTLVLIRLRCADGIEGLGESTTIGGLAYG
NESPDSIKTNIDRFVAPLLIGQDASNINAAMLRLEQSIRGNTFAKSGIESALLDAQGKRL
GLPVSELLGGRVRDALPVAWTLASGDTAKDIAEAQKMLDLRRHRIFKLKIGAGEVDRDLA
HVIAIKKALGDSASVRVDVNQAWDEAVALRACRILGGNGIDLIEQPISRNNRAGMVRLNA
SSPAPIMADESIECVEDAFNLAREGAASVFALKIAKNGGPRATLRTAAIAEAAGIGLYGG
TMLEGGIGTLASAHAFLTLNKLSWDTELFGPLLLTEDILAEPPVYRDFHLHVSKAPGLGL
SLDEERLAFFRRDKTTPVLHHT
Download sequence
Identical sequences A0A2C9EPT8 Q4K9X1
gi|70731221|ref|YP_260962.1| 220664.PFL_3862 NYSGXRC-9450f gi|501681364|ref|YP_008001190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]