SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4KJ87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q4KJ87
Domain Number - Region: 10-75
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.034
Family Anti-sigma factor antagonist SpoIIaa 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4KJ87
Sequence length 288
Comment (sp|Q4KJ87|PSD_PSEF5) Phosphatidylserine decarboxylase beta chain {ECO:0000255|HAMAP-Rule:MF_00662} KW=Complete proteome; Reference proteome OX=220664 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5). GN=PFL_0552; OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKKRLFIISQYLLPHHLLSRLAGCIAECRVRWFKNAFTRWFAKQYQVDMSEAQVEDVTAY
EHFNAFFTRALKDGARPLDPTPGAVLSPADGAVSQLGPIEHGRVFQAKGHSYSVLELLGG
DPALAQPFMGGDFATIYLSPKDYHRVHMPLAGTLREMVYVPGRIFSVNQTTAENVPELFA
RNERVVCIFDTERGPMALVLVGAMIVASIETVWAGLVTPPKRELKTVRYDEAARAPIHLE
KGAEMGRFKLGSTAIVLFGPDQVQWAQELAAGSPVRMGQGLGLGLPKA
Download sequence
Identical sequences Q4KJ87
WP_011058925.1.14038 WP_011058925.1.18072 WP_011058925.1.42693 PlR35 220664.PFL_0552 gi|70734056|ref|YP_257696.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]