SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4KLG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4KLG9
Domain Number 1 Region: 84-144
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000000114
Family AN1-like Zinc finger 0.0017
Further Details:      
 
Domain Number 2 Region: 5-49
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000353
Family AN1-like Zinc finger 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4KLG9
Sequence length 257
Comment (sp|Q4KLG9|ZFN2B_RAT) Arsenite-inducible RNA-associated protein-like protein KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Zfand2b; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAHHHCGSAYQKDIQVPVCPLC
NVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERSGCRQREMMKLTCDRCGR
NFCIKHRHPLDHDCSGEGHPTSRAGLAAISRAQGLASTSTVPSPSRTLPSSSSPSRATPQ
LPPRTTSPVIALQNGLSEDEALQRALELSLAEAKPQIPSSQEEEDLALAQALSASEAEYQ
QQQAQSRSLKPSNCSLC
Download sequence
Identical sequences Q4KLG9
NP_001020916.1.100692 NP_001020916.1.4139 10116.ENSRNOP00000025219 ENSRNOP00000025219 ENSRNOP00000025219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]