SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4S7U1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4S7U1
Domain Number 1 Region: 854-1002
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-38
Family Regulator of G-protein signaling, RGS 0.0000901
Further Details:      
 
Domain Number 2 Region: 1190-1286
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.34e-28
Family Ras-binding domain, RBD 0.00088
Further Details:      
 
Domain Number 3 Region: 274-395
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-20
Family Phosphotyrosine-binding domain (PTB) 0.0098
Further Details:      
 
Domain Number 4 Region: 2-83
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-20
Family PDZ domain 0.0091
Further Details:      
 
Domain Number 5 Region: 1136-1204
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000413
Family Ras-binding domain, RBD 0.072
Further Details:      
 
Weak hits

Sequence:  Q4S7U1
Domain Number - Region: 553-563
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00366
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4S7U1
Sequence length 1510
Comment (tr|Q4S7U1|Q4S7U1_TETNG) Chromosome 18 SCAF14712, whole genome shotgun sequence {ECO:0000313|EMBL:CAG03291.1} OX=99883 OS=nigroviridis). GN=GSTENG00022635001 OC=Tetraodon.
Sequence
RIRAVEVARGRTGYGFTLSGQSPCVLSRILKGSPADYVGLRSGDYILSVNDINVSKASHE
DVVKLIGRCSGVLKLVTAEGERHRRHHHQHQQRSAGSRHNSGGAKAAAYLDSCSSEEDLD
PLYDNSVNNNNNSRSGGGGRGGWYKPKLDPRQLGIDRAERVVAELQSGGIFNMIFENSSH
SSSSSDKDRPGVPAPAKPRPPSDPDFAPYRKSSRSQSNPNLLSEEEMAQVLHDDSVFLES
DFHHLHLHRQEEQDADVGDGADLMSESGEGILTVGMIVGYLGSIELASTGTSLENDSLQA
IRCSMRRLRAEQKIHSLVLMKVMHDSVRLCSDKGQVLATYPAEKLAFSACCPDDRRFFGL
VTMQATDDLDERRFGRGREDEGSLRTSCHVFIVDPELCLHQVKRRGEGSENVQFQRLSLF
FFLLQVHLGVARRFGFECTPDPDTGGCLEFPPSSHPLLQFVSILYRDMGDGIEGVRARAF
NDPDNDAQQNHSTSSNSDSGIGNFLQEEKSNRVLLVDLGGPPNHSSGPRHWESPPSSQQA
WSPTLGAAASHPPLPPPPPPPPPLRNGQYRHESHMADLPHPLPLAHSDVSARHSRGVHPH
SPAHAHARADPLYLGNTAGHVGMKCRQVLLLISQSDSTRVPDGPQEPVAAPHQPLAGCRQ
HGKIPKSPLQTQGSGGRFRGLTMGFPPLPQRSSSRRSFGRSKRLSLARSLDDLELVPEGQ
RAASNVPLGGCCGGGGQWGWRMLRRDALVPVGCRYMRLHPVFLACSRSRSPMGACLYGNG
ACLQENGTSSSHWRQHVCKGREVLGCREEGGVCRGLRRSGSYQLHPGEQPGGTGTRKLNS
VELQGCSSDNSLNSNASLPSVQSHRRHTERRVASWAVSFERLLQDPVGVRYFSEFLKKEF
SEENILFWQACEFFSHVPESDKKQLSQRAREIYKSFLSSKATTPVNIDSQAQLADDILNA
PRPDMFKEQQLQIYNLMKFDSYTRFLKSLLYQECMLAEVEGRPLPDPYHIPSSPTSKHST
TGSDRSNLSTPKKEDKKSKSGRSLNDDSRDDSGDRRKGMFFSWSRNRSFGKGPKKRELAD
FNYNFSTINGRRESQGSLSSGASLELGTSGSGKNEGDVCRGAASAERGGGSAPLRQCNIS
LPDGSCCSVPLRAGVTIRDLLMGLCEKLCINLAAVDLFLVGGEKPLVLDQDCMTLCSRDL
RLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLHLSDLVARISGELEPLDL
GLPISNLDGLRVVLDTAEDPVSKDRQVVPSTSRTQSATGEARPSGTAGSARPTGENGQAG
PSSDPGRQAFPTHSVSLHTALEKRKQKKINIDEAEEFFDLISKAQSNRADDQRGLLNKSD
LQLPDFLQLSPDQAAPPPHPPGPAAPPLIPVTPTTAASRAAVAGAIRRTSSEGADAAATC
SARATSPRAWTLRWGTRAEEGGKPGLPPLRLHSPAPSRPSARRRPLSSISPRTLSGEGGS
RCRRRTPCRT
Download sequence
Identical sequences Q4S7U1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]