SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4TDK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4TDK9
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily E set domains 7.93e-49
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q4TDK9
Sequence length 168
Comment (tr|Q4TDK9|Q4TDK9_TETNG) Chromosome undetermined SCAF6185, whole genome shotgun sequence {ECO:0000313|EMBL:CAF89023.1} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=GSTENG00002740001 OC=Tetraodon.
Sequence
GKLCLMVRVANMRKSLLIQCQLTGKLLHPSVTQEGEKTLVHQSPVDFYMDSSGDCPFLIL
PLTFYHVLDEHSPLAGLNARNLRRHDFELLVTLNATMESTAATCQSRTSYIPQEILFGYE
FRPVLFSTTGGRYVADFNFFDKVQLSSDSGFHSNDKEKLQLEEDYKKE
Download sequence
Identical sequences Q4TDK9
ENSTNIP00000004888 ENSTNIP00000004888 99883.ENSTNIP00000004888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]