SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4V8D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4V8D6
Domain Number 1 Region: 73-166
Classification Level Classification E-value
Superfamily Cyclin-like 0.00000000000000945
Family Transcription factor IIB (TFIIB), core domain 0.024
Further Details:      
 
Domain Number 2 Region: 5-42
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000000623
Family Transcriptional factor domain 0.019
Further Details:      
 
Weak hits

Sequence:  Q4V8D6
Domain Number - Region: 201-237
Classification Level Classification E-value
Superfamily Cyclin-like 0.00178
Family Transcription factor IIB (TFIIB), core domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4V8D6
Sequence length 416
Comment (sp|Q4V8D6|BRF2_RAT) B-related factor 2 KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Brf2; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MPNGSRCPDCGSSELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTG
ENEQVSRSQQRDLRRVRDLCRILKLPLTFEETAVSYYQKAYQLSGIRAARLQKKEVVVGC
CVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLADLVKSYCSSF
KLFQASPSMPAKYVEDKDKMLSRTLLLVELANETWLVTGRHPLPIITAATFLAWQSLRPS
DRLTCSLARFCKLANVDLPYPAASRLQELLAVLLQMASQLAWLQVLRLDKRSVVKHIGDL
LQHRHMLVRMAFQDGTAEVETKQQQPQGRGQQEEVGDSTFDLPKRKRPASPALLLPPCML
KPPKRTHTMPPDSVVTGDEDISDSEIEQYLRTPQEVRDFERAQAASRAAMSVPNPP
Download sequence
Identical sequences Q4V8D6
NP_001019944.1.100692 NP_001019944.1.4139 10116.ENSRNOP00000017324 ENSRNOP00000017324 ENSRNOP00000017324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]