SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4W9D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4W9D2
Domain Number 1 Region: 64-99
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000051
Family Zn2/Cys6 DNA-binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 10-39
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000101
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4W9D2
Sequence length 384
Comment (tr|Q4W9D2|Q4W9D2_ASPFU) C6 and C2H2 transcription factor, putative {ECO:0000313|EMBL:EAL84309.2} KW=Complete proteome; Reference proteome OX=330879 OS=A1100) (Aspergillus fumigatus). GN=AFUA_4G01105 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MPPQPLSGSSLPPFQCDHPGCGAKYRRKEHLNRHAASHSRGDCFSCPDLLRRHIRIYHPN
RAPPASRAQKACAACHARKERCYGGFPCSACQKRGIACSPGKGKTPEEQIVDNNVQISQQ
PHPPRWIALDYVDIYFDNFHPKWPFLHRGTFDVTKEPCVLIQSVVMIGLWIEGSKKSREA
ATDLHRSLSTAIRTQMDRWRVFNQNQSTSWPMATYQSVLLQCIFALFLAWERKAIDLNLR
YQIQDDEHDLLVTLVESCRLGGIFSYPNMLAQHSSGVPLTLVWLSLEEIKRFGLALYKVC
RLSTRLDPSRADGSSAQSELLTLADLSFGMPDSDEAWNSISGVGCEVRQEEAFQTKLRDG
QDPTGWISQSASVLSNARVAFDWI
Download sequence
Identical sequences B0YF53 Q4W9D2
5085.CADAFUAP00002484 Afum_A1163:AFUB_101600.t1 XP_746347.2.65241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]