SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4WVR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4WVR4
Domain Number 1 Region: 195-550
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.59e-84
Family IF2B-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q4WVR4
Sequence length 556
Comment (tr|Q4WVR4|Q4WVR4_ASPFU) Translation initiation factor eif-2b delta subunit {ECO:0000313|EMBL:EAL91312.1} KW=Complete proteome; Reference proteome OX=330879 OS=A1100) (Aspergillus fumigatus). GN=AFUA_5G13040 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MATPINPPVPSSTSESATTAPAQQQSTSEMQPQQQQPPREPKGAAKNASKPAKQSQNPKE
GTPAADGASPADAGSQKLTPAELKKKAKAEKAARRAKERAEREQAGGAAPAQGANPPFAK
KGQTGAGGGGGAGGKDAAAAQSQKGRGYLPRRGSAQAAAGGAEQKKKQEDKNVAVFGHLY
GQQRRTTVAGAGKEVHPAVLALGLQMRDYVICGSSARCVATLLAFKRVIESYTTPLGTSL
ARHLTTHLSHQITYLSTCRPLSISQGNAIRALKLAISSIDPSVPEASAKASLSDFIDSFI
REKITVADQVIADSAAQKIQDGDVIVTYAGSSIVKQTLLTAHKQGKKFRVSIIDSRPLFE
GKNLARTLAKAGLEVQYSLVNGISHAIKDATKVFLGAHAMTSNGRLYSRVGTALVAMSAK
ERAGGVEVPVIVCCETVKFTDRVALDSIVVNEIADADELVMNEPLQQVTGLPDAAAVAQP
EPKKGNKSAANATPSESTVVTPGTSPLKDWKDTPNLQLLNIMYDVTPAEYVDMVVTEMGS
LPPSAVPIVHRMSTNM
Download sequence
Identical sequences B0Y1T2 Q4WVR4
5085.CADAFUAP00006189 XP_753350.1.65241 Afu5g13040 Afum_A1163:AFUB_060750.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]