SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q55670 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q55670
Domain Number 1 Region: 5-117
Classification Level Classification E-value
Superfamily RbcX-like 1.09e-36
Family RbcX-like 0.000000722
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q55670
Sequence length 138
Comment (tr|Q55670|Q55670_SYNY3) Uncharacterized protein {ECO:0000313|EMBL:BAA10191.1} KW=Complete proteome; Reference proteome OX=1111708 OS=Synechocystis sp. (strain PCC 6803 / Kazusa). GN=rbcX OC=Synechocystis.
Sequence
MFMQTKHIAQATVKVLQSYLTYQAVLRIQSELGETNPPQAIWLNQYLASHSIQNGETFLT
ELLDENKELVLRILAVREDIAESVLDFLPGMTRNSLAESNIAHRRHLLERLTRTVAEVDN
FPSETSNGESNNNDSPPS
Download sequence
Identical sequences Q55670
gi|16331393|ref|NP_442121.1| gi|16331393|ref|NP_442121.1| gi|383326303|ref|YP_005387156.1| gi|383323134|ref|YP_005383987.1| gi|383492187|ref|YP_005409863.1| 1148.slr0011 WP_010873419.1.11876 WP_010873419.1.1889 WP_010873419.1.18904 WP_010873419.1.33690 WP_010873419.1.35395 WP_010873419.1.47586 WP_010873419.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]