SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q56P27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q56P27
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 3.47e-43
Family Nip7p homolog, N-terminal domain 0.00000193
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 8.84e-27
Family PUA domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q56P27
Sequence length 180
Comment (sp|Q56P27|NIP7_PIG) 60S ribosome subunit biogenesis protein NIP7 homolog KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=NIP7; OC=Sus.
Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKILKLAANISG
DKLMSLGTCFGKFTKTHKFRLHITALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGR
ITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Download sequence
Identical sequences Q56P27
NP_001041536.1.46622 ENSSSCP00000002978 ENSSSCP00000002978 9823.ENSSSCP00000002978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]