SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q57W83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q57W83
Domain Number 1 Region: 7-153
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000105
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q57W83
Sequence length 422
Comment (tr|Q57W83|Q57W83_TRYB2) Uncharacterized protein {ECO:0000313|EMBL:AAX70136.1} KW=Complete proteome; Reference proteome OX=185431 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1). GN=Tb927.8.2890 OC=Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
Sequence
MMSSLLADTQFSGRAGLLSWINKMCSAQYPSVVSLRDGAAYCSVVDATANRVAENCAAFG
VPELTVYQKRAKRSSQLLARVSWGATLATCANQDPSLDSIKERNQCERNMQTLQIMLYEC
LPPEFSLEIDVPRLACGKLQDHVQLLKRMHIIVGKLLTLFSKQSLELRIRSSSNFGCVEG
VRITRAMMLHRKASQKYINDHSPSRLKREDAGIFGDTRGHLSLSTNQKSAPRCGNDNVMP
VTPGRYTVLSKGQKGPPNSRGTHSAEGTELRSSLFSTAGSDGCGSLESRCSSTTGMSKPF
FTVPQRYCHLLGDLRQEVESYEALVQASQGRHQRGLLAGECGSNDDAQMVERSGISTFHG
DAPVVCLESLGTLSGKRDKLWQTLSVIHGTAAHRATELGIGGNGKASAPPLLGDILSALT
LQ
Download sequence
Identical sequences A0A1G4IAW7 Q57W83
gi|72392641|ref|XP_847121.1| 5691.Tb927.8.2890 Tb927.8.2890 XP_847121.1.54365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]