SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5AYS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5AYS1
Domain Number 1 Region: 16-69
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000385
Family Centromere-binding 0.034
Further Details:      
 
Weak hits

Sequence:  Q5AYS1
Domain Number - Region: 529-554
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.017
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5AYS1
Sequence length 554
Comment (tr|Q5AYS1|Q5AYS1_EMENI) Uncharacterized protein {ECO:0000313|EMBL:CBF70985.1} KW=Complete proteome; Reference proteome OX=227321 OS=194 / M139) (Aspergillus nidulans). GN=ANIA_04391 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MPRVRVSSSQNCHEKEGRLLLAVQAIKKKEITSIREAARRFNVPESTLRTRLRGTTNRAE
SRANGHKLTEIEEEVLKQWILSLDLRGAAPTKAHVREMANILLAKRGSTPIQTVGQKWVY
NYTQRHPELESRLSRQYDCQRAKQENPKVIQAWFNTVRATIEQYGILPDDIYNFDETGFA
MGLCAHQKVITKSESCGRRPVLQPGNREWVTAIESISASGWALPPTLIFKGKQYNQAWFT
GLPPDWRFEISTNGWTTNEISLRWLQKQFIPSTEHRTRGRYQLLVLDGHGSHLTPEFDQI
CTDHNIIPLCMPAHSSHLLQPLDIGCFAVLKRSYASLVDQKMRLGISHIDKLDFLAAYPQ
ARISTFKLDTIRNSFRAAGLVPLNPEPVLSKLSIQARTPTPPGSRGSQASTFCPHTPANV
DELLKQASLLRDFLKQRSKSPPSPSHNALNQLIKGCQIAMQKGILLEQENRALRAENAIQ
RRKRARTHRWIAHDNGLSVQEATELEEAHNASFQAIPGPCGPPAEGAQTPKARALPTCST
CHRIGHRRNACPNK
Download sequence
Identical sequences A0A1U8QHT8 G5EAV2 Q5AYS1
162425.CADANIAP00006066 162425.CADANIAP00007333 XP_661995.1.1458 XP_664163.1.1458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]