SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5B7K2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5B7K2
Domain Number 1 Region: 16-69
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000385
Family Centromere-binding 0.034
Further Details:      
 
Weak hits

Sequence:  Q5B7K2
Domain Number - Region: 529-554
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.017
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5B7K2
Sequence length 554
Comment (tr|Q5B7K2|Q5B7K2_EMENI) Transposase Tan1-Aspergillus niger (ANG_orthologue An07g09460) {ECO:0000313|EMBL:CBF76072.1} KW=Complete proteome; Reference proteome OX=227321 OS=194 / M139) (Aspergillus nidulans). GN=ANIA_03478 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MPRVRVSSSQNCHEKEGRLLLAVQAIKKKEITSIREAARRFNVPESTLRTRLRGTTNRAE
SRANGHKLTEIEEEVLKQWILSLDLRGAAPTKAHVREMANILLAKRGSTPIQTVGQKWVY
NYTQRHPELESRLSRQYDCQRAKQENPKVIQAWFNTVRATIEQYGILPDDIYNFDETGFA
MGLCAHQKVITKSESCGRRPVLQPGNREWVTAIESISASGWALPPTLIFKGKQYNQAWFT
GLPPDWRFEISTNGWTTNEISLRWLQKQFIPSTEHRTRGRYQLLVLNSHGSHLTPEFDQI
CTDHNIIPLCMPAHSSHLLQPLDIGCFAVLKRSYASLVDQKMRLGISHIDKLDFLAAYPQ
ARISTFKLDTIRNSFRAAGLVPLNPEPVLSKLSIQARTPTPPGSRGSQASTFCPHTPANV
DELLKQASLLRDFLKQRSKSPPSPSHNALNQLIKGCQIAMQKGILLEQENRALRAENAIQ
RRKRARTHRWIAHDNGLSVQEATELEEAHNASFQAIPGPCGPPAEGAQTPKARALPTCST
CHRIGHRRNACPNK
Download sequence
Identical sequences A0A1U8QGC9 Q5B7K2
XP_661082.1.1458 162425.CADANIAP00005279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]