SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5BFH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q5BFH3
Domain Number - Region: 264-288
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000142
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 
Domain Number - Region: 923-1010
Classification Level Classification E-value
Superfamily Autotransporter 0.0183
Family Autotransporter 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5BFH3
Sequence length 1032
Comment (sp|Q5BFH3|XRN2_EMENI) 5'-3' exoribonuclease 2 KW=Complete proteome; Reference proteome OX=227321 OS=194 / M139) (Aspergillus nidulans). GN=rat1; OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MGVPALFRWLSKKYPKIISSVIEELPQEVNGEEIPVDITGPNPNGEEMDNLYLDMNGIVH
PCTHPEGKPPPANEQEMMIEIFKYTDRVVNMVRPRKLLMIAVDGVAPRAKMNQQRARRFR
SAQEAREQDEKKQEFQRMLAKQNGDKEQMLQEEVIQKTWDSNVITPGTPFMDILAASLRY
WIAYKLNTDPAWEKLKIIISDATVPGEGEHKIMEFIRSQRASPEHDPNARHVIYGLDADL
IMLGLATHEPHFRVLREDVFFQESKQRTCHLCGQPGHKAEECRGQAKEKNGEFDEKGKGA
TLKPFIWLHVSILREYLAAELYVPHQPFPFDLERALDDWVFMCFFVGNDFLPHLPSLDIR
EDGIDTLIAIWRDNIPLMGGYLTQDGRVDLKKAQLILQGLAKQEDAIFRRRRQAEERKLA
NEKRRKQEEKARNEERARKRRRSSPSYDAIESPTHAKPRSAGAAAAPPAGLELITPARGE
LARQTRELTHSMVVNRGNVYRANMANKSAAAVLKSKLLGGQDGQPSDDGESTAESDAQLD
AAGPVLGKRKADEAEVGQLGTETPDKPEPAKADELPPDTVRLWEEGYADRYYEQKFGVDP
QDKEFRHKVARAYAEGLAWVLLYYFQGCPSWTWYYPYHYAPFAADFVDIGDMELSFEKGT
PFKPYEQLMGVLPASSNHAIPKVFHSLMTEPDSEIIDFYPEDFPVDLNGKKFAWQGVVLL
PFIDEKRLLAAMSKKYPLLTEDEKARNTVGRDVLLLSESHPLYQDLVSNFYSKKQGAPKY
KLNMRVSDGLAGKVEKNEAYIPHSSLVSSLEEYGMPSLEDDRSIMVNYEIPKSTNIHKSM
LLRGVKFGPPALDNADIQATKSRAQHSGRSYGGAPFRGGRGGRMNYAGDRQSHGNDRPNP
FAAHLDPKFMPGANPGAPMGMPSGWVPPSGNFSRGPPPPPRGGTSYGYGSQQYGSYGGYG
QQQSYQQSSHSQSDYYGRGPPAPYNNGPADYYSGRPSGYGPQESRGGGYNRGGYRGGRDT
YSSSGHGGYGRY
Download sequence
Identical sequences Q5BFH3
162425.CADANIAP00001962 XP_658311.1.1458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]