SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5BJ89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5BJ89
Domain Number 1 Region: 199-342
Classification Level Classification E-value
Superfamily PH domain-like 2.14e-44
Family Third domain of FERM 0.000000281
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.07e-37
Family Second domain of FERM 0.00000169
Further Details:      
 
Domain Number 3 Region: 494-582
Classification Level Classification E-value
Superfamily Moesin tail domain 2.09e-31
Family Moesin tail domain 0.0000344
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.2e-25
Family First domain of FERM 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5BJ89
Sequence length 582
Comment (tr|Q5BJ89|Q5BJ89_XENTR) Ezrin {ECO:0000313|EMBL:AAH91578.1, ECO:0000313|Ensembl:ENSXETP00000061887} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=ezr OC=Silurana.
Sequence
MPKPVNVRVTTMDAELEFAIQPSTTGKQLFDQVIKTVGLREVWYFGLQCIDNKGYLTWLK
LDKKVSAQEVKKENPLQFKFRAKFYPEDVSEELIQEITQKLFFLQVKEAILSDEVYCPPE
TAVLLASYAVQAKFGDYSKETIKSGYLTSERLLPQRVLDQHNLSRDQWEERIEVWHSEHR
GMLKEDAMLEYLKIAQDLEMYGINYFEIKNKKGSDLWLGVDALGLNIYEHNDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAKEEKLQKQLERQQLEQEKKKREAIEREREQMIKEKEELMFRLHEYEEQSKR
AERELSEQIQRAKELEEERRRAQYEAERLEAERISALRAKEELERQAIAQTKSQEQLASE
LSEYTARISLLEEARRVKEDEASEWQMRAQEAQTDLLRTREELHMVMTTPPPPPPPVYEP
YRVHEPDDGLEHTSYSAELSSVDFLEDNKMQTRMTEAEKNERVQRQLMALTSELSQARDE
TKKTHNDILHTENVKSGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences Q5BJ89
ENSXETP00000061887 gi|60552277|gb|AAH91578| gi|71895991|ref|NP_001025629| NP_001025629.1.99540 ENSXETP00000061887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]