SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5BK74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5BK74
Domain Number 1 Region: 171-279
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.44e-34
Family Elongation factor TFIIS domain 2 0.0029
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 4.05e-26
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000433
Further Details:      
 
Domain Number 3 Region: 304-346
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 4.14e-16
Family Transcriptional factor domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5BK74
Sequence length 348
Comment (tr|Q5BK74|Q5BK74_RAT) Transcription elongation factor A3 {ECO:0000313|Ensembl:ENSRNOP00000015776} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Tcea3 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MGLEEELLRIAKKLEKMVARKKTEGALDLLKKLNSCQMSIQLLQTTRIGVAVNGVRKHCS
DKEVVSLAKVLIKNWKRLLDSPRTTKGEREAREKAKKKEKGLGSSGWKPEAGLSPPRKKE
GGEPKTRRDSVDSRSSTTSSPKRPSLERSNSSRSKVETPKTPSSPSTPTFAPAVCLLASC
YLTGDSVRDKCVEMLSAALKAEDDFKDYGVNCDKLASEIEDHIYQELKSTDMKYRNRVRS
RISNLKDPRNPGLRRNVLSGTISPELIAKMTAEEMASDELRELRNAMTQEAIREHQMAKT
GGTTTDLLRCSKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC
Download sequence
Identical sequences Q5BK74
NP_001015008.1.100692 NP_001015008.1.4139 ENSRNOP00000015776 10116.ENSRNOP00000015776 ENSRNOP00000015776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]