SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5CZV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5CZV3
Domain Number 1 Region: 54-151
Classification Level Classification E-value
Superfamily Histone-fold 2.55e-39
Family TBP-associated factors, TAFs 0.0000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5CZV3
Sequence length 205
Comment (tr|Q5CZV3|Q5CZV3_DANRE) Nuclear transcription factor Y, beta {ECO:0000313|EMBL:AAH90693.1} OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=nfyb OC=Cyprinidae; Danio.
Sequence
MDGESSTTDASQLGMTGEYMASSHFVLHAQDDEGDDGLNDHEDGNGSKDNLREQDIYLPI
ANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFA
MSTLGFDMYVEPLKLYLQKFREAMKGEKGISTVTVTEGMGDELTDESFANPLPAGIITAD
GQQQNVMVYTTAYQQIPGVQQLQFS
Download sequence
Identical sequences Q5CZV3
NP_001013340.1.45394 ENSDARP00000067071 7955.ENSDARP00000067071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]