SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5E0X3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5E0X3
Domain Number 1 Region: 1-210,322-402
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.11e-82
Family Bacterial dinuclear zinc exopeptidases 0.0000000244
Further Details:      
 
Domain Number 2 Region: 209-319
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 4.18e-39
Family Bacterial exopeptidase dimerisation domain 0.0000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5E0X3
Sequence length 409
Comment (sp|Q5E0X3|PEPT_VIBF1) Tripeptide aminopeptidase {ECO:0000255|HAMAP-Rule:MF_00550} KW=Complete proteome; Reference proteome OX=312309 OS=Vibrio fischeri (strain ATCC 700601 / ES114). GN=VF_A0253; OC=Vibrionaceae; Aliivibrio.
Sequence
MKDLVERFLSYVSIDTQSNPSAPQCPSTEKQFNLANQLVSELNELELSDVSIDENGYVMG
RLPSNVDYDVPAIGFIAHMDTAPDASGENVKPQIINNYQGDIITLGTSGEELTPSQFPDL
LNLIGHDLITTDGTTLLGADNKAGIAEILTAIAVLKANPEIPHGDICVGFTPDEEIGRGA
NLFDVKKFNAKWAYTIDGGPVGELEYENFNATSADVICHGVNVHPGTAKGKMVNSMNIAA
QFQMMMPADETPEGTEGYEGFYHLKSMNAGVAKTELGYIVRDFSREGMAERKAFMQQKVN
ELNAKLEKGRVELVLTDSYFNMREMVEPHPHVIELAKEAMTACDIQPDIKPIRGGTDGAR
LSFMGLPCPNIFTGGYNFHGIHEFITINGMKQAVDVIVKIAELNASNNK
Download sequence
Identical sequences Q5E0X3
312309.VF_A0253 gi|59713436|ref|YP_206211.1| WP_011263146.1.76652 YP_206211.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]