SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5E2S8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5E2S8
Domain Number 1 Region: 439-540
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000922
Family Anti-sigma factor antagonist SpoIIaa 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5E2S8
Sequence length 551
Comment (tr|Q5E2S8|Q5E2S8_VIBF1) Predicted transporter {ECO:0000313|EMBL:AAW86668.1} KW=Complete proteome; Reference proteome OX=312309 OS=Vibrio fischeri (strain ATCC 700601 / ES114). GN=VF_2173 OC=Vibrionaceae; Aliivibrio.
Sequence
MFGQRFDNINLKGDLFGGVTTAIISLPLALAFGVASGAGAEAGLWGAIMVGLFASLFGGS
STLISEPTGPMTVIMTAVLTSMVAKYPETGMAMTFTVVMMAGAFQILLGTLKLGKYITLM
PYSVISGFMSGIGVILIILQLSPLLGHAAPPGGVIGTLSALPDTLSNLDIKELFLGGLTL
GVLFLFPDKYRKYVPAQLVALVAVTLLSVLFFDMESIRRIGEIPAGLPSLVIPTINFEMF
TTMVIDALVLGTLGCIDTLLTAVIGDSLTRKEHDSDKELRGQGLANMISGLFGALPGAGA
TMGTVTNIQVGARSPLSGVFRAAVLALVVLVAGGLTEPIPMAVLAGIAVYVGFNILDWSF
IQRAHKVSFAGMAIMYGVMLLTVFVDLIVAVGLGVFISNIIIIERLSREQARQVKAISDA
DEDDVPLTDSERALLDKANGKVLFFYLSGPMIFSVSKAISRQHSSISDYEVMILDLTDVP
MIDVTVGLALENAINDALDANCKVYLLCPNEQTKEQLDKFHVTDLIPSENTYKFRYEALK
SAIKYVSPSED
Download sequence
Identical sequences Q5E2S8
GO.9173 gi|59712780|ref|YP_205556.1| 312309.VF_2173 WP_011262614.1.76652 YP_205556.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]