SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5E5Z1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5E5Z1
Domain Number 1 Region: 2-210,321-404
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.66e-64
Family Bacterial dinuclear zinc exopeptidases 0.00000254
Further Details:      
 
Domain Number 2 Region: 209-318
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 8.06e-29
Family Bacterial exopeptidase dimerisation domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5E5Z1
Sequence length 409
Comment (tr|Q5E5Z1|Q5E5Z1_VIBF1) Peptidase T {ECO:0000256|SAAS:SAAS00756400} KW=Complete proteome; Reference proteome OX=312309 OS=Vibrio fischeri (strain ATCC 700601 / ES114). GN=VF_1060 OC=Vibrionaceae; Aliivibrio.
Sequence
MNVVERFLGYTKINTTTNQANGAAGIMPSSEGQYELACLVKKELEALGCTDILLRDTAIL
TATLPSNTEKKLPTVAFFGHLDTSSERTEDTHAVVVHYKGGDIPLATGPVLSLAEYPELT
NYIGQDIIVSDGQSLLGADDKAAIAAILNALQFFKDNPDVEHGMVKVGFVPDEEQGLLGA
NAFDVDGFGADFAYTLDCCGIGEFVCENWNAGNAVVTFTGQSAHPMNSKGNLINSLLLAN
SFMSRFPEKETPEHTEGREGYYWMKKLAGNSAKTVLNMDIRDFTESGYMYRKAFIAEQVR
MFNEENNNRATLELSDRYSNVHNFLKGSMLPVDLAMEAYKENDIEPKVIPMRGGYDGAVL
SEKGLPCPNIFTGAHNFHSIFEYLPVPSLIAASNVVKTIIINLTKHEEV
Download sequence
Identical sequences Q5E5Z1
gi|59711667|ref|YP_204443.1| WP_011261693.1.76652 YP_204443.1.56684 312309.VF_1060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]