SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5JSP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5JSP0
Domain Number 1 Region: 154-358
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-56
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 342-474
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-31
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 3 Region: 452-493,531-596
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.45e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 
Domain Number 4 Region: 606-702
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-21
Family Pleckstrin-homology domain (PH domain) 0.0000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5JSP0
Sequence length 725
Comment (sp|Q5JSP0|FGD3_HUMAN) Zinc finger FYVE domain-containing protein 5 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FGD3; OC=Catarrhini; Hominidae; Homo.
Sequence
MESGRGSSTPPGPIAALGMPDTGPGSSSLGKLQALPVGPRAHCGDPVSLAAAGDGSPDIG
PTGELSGSLKIPNRDSGIDSPSSSVAGENFPCEEGLEAGPSPTVLGAHAEMALDSQVPKV
TPQEEADSDVGEEPDSENTPQKADKDAGLAQHSGPQKLLHIAQELLHTEETYVKRLHLLD
QVFCTRLTDAGIPPEVIMGIFSNISSIHRFHGQFLLPELKTRITEEWDTNPRLGDILQKL
APFLKMYGEYVKNFDRAVGLVSTWTQRSPLFKDVVHSIQKQEVCGNLTLQHHMLEPVQRV
PRYELLLKDYLKRLPQDAPDRKDAERSLELISTAANHSNAAIRKVEKMHKLLEVYEQLGG
EEDIVNPANELIKEGQIQKLSAKNGTPQDRHLFLFNSMILYCVPKLRLMGQKFSVREKMD
ISGLQVQDIVKPNTAHTFIITGRKRSLELQTRTEEEKKEWIQIIQATIEKHKQNSETFKA
FGGAFSQDEDPSLSPDMPITSTSPVEPVVTTEGSSGAAGLEPRKLSSKTRRDKEKQSCKS
CGETFNSITKRRHHCKLCGAVICGKCSEFKAENSRQSRVCRDCFLTQPVAPESTEKTPTA
DPQPSLLCGPLRLSESGETWSEVWAAIPMSDPQVLHLQGGSQDGRLPRTIPLPSCKLSVP
DPEERLDSGHVWKLQWAKQSWYLSASSAELQQQWLETLSTAAHGDTAQDSPGALQLQVPM
GAAAP
Download sequence
Identical sequences A0A024R252 Q5JSP0
9606.ENSP00000336914 gi|134133248|ref|NP_001077005.1| gi|134133265|ref|NP_149077.2| NP_001077005.1.87134 NP_001077005.1.92137 NP_149077.2.87134 NP_149077.2.92137 XP_016870763.1.92137 ENSP00000336914 ENSP00000336914 ENSP00000364631 ENSP00000336914 ENSP00000364631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]