SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5KVZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5KVZ5
Domain Number 1 Region: 3-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.35e-62
Family ABC transporter ATPase domain-like 0.0000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5KVZ5
Sequence length 263
Comment (tr|Q5KVZ5|Q5KVZ5_GEOKA) Nitrate/sulfonate/taurine/bicarbonate ABC transporter (ATP binding protein) {ECO:0000313|EMBL:BAD77141.1} KW=Complete proteome; Reference proteome OX=235909 OS=Geobacillus kaustophilus (strain HTA426). GN=GK2856 OC=Geobacillus thermoleovorans group.
Sequence
MFLSIDRLSHTYLTKTTAVTALDDVSLSVEKGEFVSFLGPSGCGKTTLLSIIAGLIEPTE
GAVHIEGQPIWPSGTAAPAARRAVGYMLQQDYLFPWKTIEENILLGLKITDTLTADTKER
ALALLSEIGLAGVELYYPSQLSGGMRQRAALVRTLATDPKLLLLDEPFSALDQQTKLKLE
ELVWKTLKQYEKTAVLVTHDIEEAIAMSDRIFLFSPRPGRLVRTFVIPDELRCRPPLAAR
QQPSFPALFQSIWKEMEALESAQ
Download sequence
Identical sequences A0A1V9BVI2 G8N652 Q5KVZ5
gi|375009982|ref|YP_004983615.1| 235909.GK2856 WP_011232328.1.2219 WP_011232328.1.45808 WP_011232328.1.60903 WP_011232328.1.70239 WP_011232328.1.8599 WP_011232328.1.91533 WP_011232328.1.93593 gi|56421391|ref|YP_148709.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]