SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5KWF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5KWF8
Domain Number 1 Region: 293-513
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-46
Family ABC transporter ATPase domain-like 0.000053
Further Details:      
 
Domain Number 2 Region: 22-288
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.92e-28
Family DNA repair protein MutS, domain III 0.011
Further Details:      
 
Domain Number 3 Region: 707-783
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000000262
Family Smr domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5KWF8
Sequence length 784
Comment (sp|Q5KWF8|MUTS2_GEOKA) Endonuclease MutS2 {ECO:0000255|HAMAP-Rule:MF_00092} KW=Complete proteome; Reference proteome OX=235909 OS=Geobacillus kaustophilus (strain HTA426). GN=GK2693; OC=Geobacillus thermoleovorans group.
Sequence
MQPKVLHTLEFDKVKEQLAEHASSPLGLEKIDALMPSSDLEEVAAWLDETDEAAAVLRLA
GYVPLDGVVDIRPHLKRAAIGGTLSPQELLEVAATSAASRQMKRLIAGLYDEHGGLERLF
RYADTLAEAPELEHDVRRSIDDHGEVLDAASDRLRSLRGQIRSVEARIREKLESIIRSPS
AQKRLSDAIITIRNDRYVIPVKQEYRGAYGGIVHDQSASGATLFIEPQAVVELNNALREA
RAKEKQEIERILRELSAKVAEQAEPLARTVEALAALDFAFAKAKYARRLQAAKPAVNSRG
YLRFLQARHPLLDQEKAVPNDIELGGDYTTIVITGPNTGGKTVTLKTIGLLTLMAQAGLF
IPAADGSEAAVFRSVFADIGDEQSIEQSLSTFSSHMVNIVDILRHVDGESLVLFDELGAG
TDPQEGAALAIAILDEVHGRGARTVATTHYPELKAYGYNRPGVVNASVEFDTETLRPTYK
LLIGIPGRSNAFDISRRLGLDERIIERAKAQVSAESHNVENMIASLERSKKQAEEDEARA
RAALEEAERLRAEWEQKWEELEEEKAERLAEATQKAADIIRAAEREAERIIQELRRLQKE
KQAEVKEHELVEAKQRLAAAMPKVEKRKKAKKAASRHVFQPGDEVKVTSLNQKGYLIEKV
SDDEWQVQLGILKMKIHERDLEYIGSAPAKDVTPIATVKGKDAHVSLELDLRGERYEDAL
IRLEKYLDDAVLAGYARVSIIHGKGTGALRQGVQQFLKQHRAVKSFRFGEANEGGTGVTI
VELK
Download sequence
Identical sequences A0A063YL66 Q5KWF8
235909.GK2693 gi|56421228|ref|YP_148546.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]