SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5KXX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5KXX5
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.73e-53
Family DnaQ-like 3'-5' exonuclease 0.002
Further Details:      
 
Domain Number 2 Region: 270-324,406-476,651-665,699-870
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.59e-25
Family Tandem AAA-ATPase domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5KXX5
Sequence length 909
Comment (tr|Q5KXX5|Q5KXX5_GEOKA) ATP-dependent helicase DinG homolog {ECO:0000256|RuleBase:RU364106} KW=Complete proteome; Reference proteome OX=235909 OS=Geobacillus kaustophilus (strain HTA426). GN=GK2176 OC=Geobacillus thermoleovorans group.
Sequence
MATRFVIIDLETTGNGPKKGDRIIQLGMAVVEDGLIVERFASFFNPEQPIPLFIQQLTNI
NEEMVEGAPLFADKAGEIAALMHGAYFVAHNVDFDLPFLQAELERAGWPPFSGPTIDTVE
LARIVLPTAESYKLGDLARQLGLHHNRPHQADSDAEVTAKLFIALLKRLSRLPLMTLEQL
RGLARHLKSDIYLLLDAVIAKKRNKAPADRAVAVYRGIALKQPAPEPDESDRRPALASFA
AFCEQEPPLPLPGYKRRAGQWEMMRLVYEALSTSQHALIEAGTGLGKSLAYLIPAAFFAC
EQQERVVISTHTLQLQEQLIRRDWPVLRQIAPFPLRVAVLKGKQNYLSLDKFASFLSEPS
DTYDAALLKCQVLVWLLETDSGDLDELNVSSGARLLLSALAIGEEEDGGRHHFFARAKER
SERADVVITNHALLLHDLTGPAPLLPPFRHLIIDEAHRLEDAAARCFGEQISYVSFRLLT
AKIAQTIAKWQEAEQDAPNGALVRCQQRLEELQFEGDELFRLLRRYALDKKPARAGRCRY
RFSPTDEQSRAWQAAVELCWRLRDLAAALSAEAKPLLSADTSGDFPPSALLSADLAALNR
QMAALVRLLTEKEPGVVRWIEADEKGAANAVRLYSQPVDLADFFADQLFMKKRSVVLTSA
TLTVRGRFTYMAARLGLEDFYPLCRSFPSPFRYEEQAALFVPADMPLVSAVPLEDYAEAV
AASVLAIARRLGRRVLVLFPSYELLKLTVDALKTEEEGEPFVLIAQGVQSGSPAKLLRTF
LQFEHAVLFGTSSFWEGVDLPGSALDVLVIARLPFAPPDDPVMEAKSERIRLEGGDPFSE
LALPEAVLRFKQGFGRLIRTEDDKGAVFVLDRRLLASPYGADFLASLPPLSVHEGALSEL
LDKAETWLS
Download sequence
Identical sequences Q5KXX5
WP_011231661.1.2219 gi|56420711|ref|YP_148029.1| 235909.GK2176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]