SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5KYC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5KYC3
Domain Number 1 Region: 4-235
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.49e-55
Family ABC transporter ATPase domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5KYC3
Sequence length 267
Comment (tr|Q5KYC3|Q5KYC3_GEOKA) ABC transporter (ATP-binding protein) {ECO:0000313|EMBL:BAD76313.1} KW=Complete proteome; Reference proteome OX=235909 OS=Geobacillus kaustophilus (strain HTA426). GN=GK2028 OC=Geobacillus thermoleovorans group.
Sequence
MRRMLQLKGIYKVFHEGTPDEKIALQNIHLTLRKGDFVTVIGSNGAGKSTLMNLISGVLF
PDEGTIWIDGQDVTMMPEYVRSRYIGRVFQDPMAGTAPNMTIEENLAMAYTRNQKRTLRR
GVTKKRRDDFRELLSTLHLGLENRLQAKVGLLSGGERQALSLLMATFTEPAILLLDEHTA
ALDPARAELITNLTKEIVERYRLTTLMVTHNMQQAIDLGNRLIMMDKGQIIFEVDENEKK
SLTVEKLLAEFQRIRGEQLASDRAVLS
Download sequence
Identical sequences Q5KYC3 V6VLC8
235909.GK2028 gi|56420563|ref|YP_147881.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]