SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5KYP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5KYP2
Domain Number 1 Region: 4-227
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.3e-55
Family ABC transporter ATPase domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 248-497
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.7e-46
Family ABC transporter ATPase domain-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5KYP2
Sequence length 513
Comment (tr|Q5KYP2|Q5KYP2_GEOKA) ABC transporter (ATP-binding protein) {ECO:0000313|EMBL:BAD76194.1} KW=Complete proteome; Reference proteome OX=235909 OS=Geobacillus kaustophilus (strain HTA426). GN=GK1909 OC=Geobacillus thermoleovorans group.
Sequence
MSEFILEMRGITKQFPGVKALDNVNLKIREGEIHALCGENGAGKSTLMKVLSGVYPYGTY
DGEILFKGEVCRFKDIKQSEQLGIVIIHQELALIPYLSIAENIFLGNERAKRGIINWNET
IAQTKKLLQKVGLEESPHTLVGQLGVGKQQLVEIAKALAKDVKLLILDEPTAALNEDDSE
NLLNLLLELKKQGLSAIIISHKLNEITKVADSITILRDGKTIETLDMKHDEVTEDRIIRG
MVGRDLTNRYPSRTPKIGEIIFEVRNWTVYHPVYSERKVLDNINLSIRRGEIVGIAGLMG
AGRTELAMSIFGRSYGKKISGEIWKNGVKIDVSDVSKAIANGIAYVTEDRKGNGLILMED
IRKNITLSRLGKISNHFVVDENQEIVESERFRDQFKIKTPSVFQKVEALSGGNQQKVVLS
KWIFAEPDILILDEPTRGIDVGAKYEIYTIIQQLADAGKGILMISSELPEILGMCDRIYV
MSEGRITGEVSREEATQEKLMRLMTKTAIQEGA
Download sequence
Identical sequences Q5KYP2
WP_011231398.1.2219 gi|56420444|ref|YP_147762.1| 235909.GK1909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]