SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5KYQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5KYQ7
Domain Number 1 Region: 5-233
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.28e-56
Family ABC transporter ATPase domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 262-487
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.22e-49
Family ABC transporter ATPase domain-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5KYQ7
Sequence length 503
Comment (sp|Q5KYQ7|RGMG_GEOKA) Putative ribose/galactose/methyl galactoside import ATP-binding protein {ECO:0000255|HAMAP-Rule:MF_01717} KW=Complete proteome; Reference proteome OX=235909 OS=Geobacillus kaustophilus (strain HTA426). GN=GK1894; OC=Geobacillus thermoleovorans group.
Sequence
MSEDYVLEMIDITKEFPGVKALDGVQLKVKRGTVHALMGENGAGKSTLMKILIGIYTPDR
GKIILDGEELKVSTIKHALDRGISMIHQELSPVPNMTVAENIFLGREPSYPFAGWVKMKE
LVKKTRQLFERLEIDIDPNAKMADLSIANMQMVEIAKAISYHSKLIIMDEPTSAITEKEV
HHLFRIIRSLKKEGVSIIYITHKMDELEQITDEVTVLRDGKYIGTKPSHQMTRDELIQMM
VGRELNQIFHKPKVPIGEVALSVQGLTKKGKFHDVSFEVRKGEIVGFAGLMGSGRTEVLE
SVFGVTKPDAGDIYVHGKKATIRSTRDAIRYGMGLLTEDRKLTGLFLPLSVEDNMITVTV
NQYTKAGFLQQRKIREDCQRLAEQLSIKTPSLQQLIKYLSGGNQQKALIARWLLHNPDIL
FLDEPTRGIDVGAKAEIYHLIFELAKNGKAIIVVSSEMPEILGLSDRVIVMHEGRKMGEL
TREEATQERIMQLATGQLIETKR
Download sequence
Identical sequences A0A1Q5SPG6 Q5KYQ7
235909.GK1894 gi|56420429|ref|YP_147747.1| WP_011231384.1.2219 WP_011231384.1.77642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]