SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5KZW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5KZW8
Domain Number 1 Region: 6-185
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.22e-42
Family G proteins 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5KZW8
Sequence length 244
Comment (tr|Q5KZW8|Q5KZW8_GEOKA) Uncharacterized protein {ECO:0000313|EMBL:BAD75768.1} KW=Complete proteome; Reference proteome OX=235909 OS=Geobacillus kaustophilus (strain HTA426). GN=GK1483 OC=Geobacillus thermoleovorans group.
Sequence
MTDMTYTIALMGNPNTGKSTLFNVLTGLRQHTGNWPGKTVTHAEGECRHRGTLYRIVDLP
GTYSLYSNSADEEVARDFLLFQRPDVTVVVVDATALERNLNLALQVLEMTDRVIIAINLM
DEAKKKGIHINTKKLAVKLGVPVVPISARNREGIDALLDTVDAMAHGRINTNPLSIRYSP
EIERGIAKLLPLVKDVMGDTYPARWIALRLLDGDTSLLQALKQPPQPLIKEGNAYACCGS
IKSI
Download sequence
Identical sequences A0A063YVA0 A0A1C3D3M5 A0A1V9BX71 Q5KZW8 V6VCV1
WP_011230979.1.19233 WP_011230979.1.2219 WP_011230979.1.22479 WP_011230979.1.25743 WP_011230979.1.45808 WP_011230979.1.60903 WP_011230979.1.70239 WP_011230979.1.90668 gi|56420018|ref|YP_147336.1| 235909.GK1483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]