SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5L0Q1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5L0Q1
Domain Number 1 Region: 123-321
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.55e-52
Family Nitrogenase iron protein-like 0.000000652
Further Details:      
 
Domain Number 2 Region: 19-97
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 1.2e-21
Family Domain of the SRP/SRP receptor G-proteins 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5L0Q1
Sequence length 328
Comment (tr|Q5L0Q1|Q5L0Q1_GEOKA) Signal recognition particle receptor FtsY {ECO:0000256|HAMAP-Rule:MF_00920} KW=Complete proteome; Reference proteome OX=235909 OS=Geobacillus kaustophilus (strain HTA426). GN=GK1194 OC=Geobacillus thermoleovorans group.
Sequence
MGFFQKWKEKWTKQADAVTEKFKEGLSKTRNSLAGKVNDLIARYRKVDEEFFEELEEILI
AADVGVTTVMELVDELKMEVKRRNIQDPAQMRDVIAEKLVDIYRAGADGKELSALNIQEG
GLTVILFVGVNGVGKTTTIGKLAHKLKSEGKSVLLAAGDTFRAGAIEQLEAWGERVGVDV
IKQAAGSDPAAVMYDAIQAAKARGVDVLLCDTAGRLQNKVNLMKELEKVKRVISREIPGA
PHEVLLVLDATTGQNAMSQAKLFKEATDVTGIVLTKLDGTAKGGIVLAIRNEMAIPVKLV
GLGEKMDDLQVFDPEQYVYGLFADLLES
Download sequence
Identical sequences Q5L0Q1
235909.GK1194 gi|56419729|ref|YP_147047.1| WP_011230694.1.2219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]