SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5L0S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5L0S5
Domain Number 1 Region: 258-441
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.15e-43
Family Tandem AAA-ATPase domain 0.0038
Further Details:      
 
Domain Number 2 Region: 530-704
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.55e-35
Family Tandem AAA-ATPase domain 0.006
Further Details:      
 
Weak hits

Sequence:  Q5L0S5
Domain Number - Region: 196-242
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00899
Family TrmB-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5L0S5
Sequence length 801
Comment (tr|Q5L0S5|Q5L0S5_GEOKA) ATP-dependent helicase PriA {ECO:0000256|HAMAP-Rule:MF_00983} KW=Complete proteome; Reference proteome OX=235909 OS=Geobacillus kaustophilus (strain HTA426). GN=GK1170 OC=Geobacillus thermoleovorans group.
Sequence
MKVASVIVDVPSRQTDRPFDYLIPERWQGIIQPGMRVTVPFGARRLQGFVVDVKDHSDIK
QLKPIEHVLDVVPVLNEELLDLGRYLTETTLCFAISAYQAMLPAAMRAKYEKTLRLTDEE
KRERLPDEVKPLFAGRTEAAWKEVEAAGLWRAAQKAVQQGVLEAVYKVKEKAGKKTVKHA
ALAIPSEQAKQELGSLPARQKEVLSFLLEKGKAASVAELQAVLGVSSAPLKALVDKGFVV
LNDVEVYRDPYEHRTFQPSEPPALTQAQEAALAKIAASVRAGEHRTFLLYGVTGSGKTEV
YMQAIDEALRQGKEAIVLVPEISLTPQMVERFKSRFGSKVAVLHSGLSVGEKYDEWRKIH
RKEVQLVVGARSAVFAPFENLGMIIIDEEHETSYKQEEMPRYHARDVAIYRARRHSCPVV
LGSATPSLETFARAAKGVYELLELPERISDRGLPDVHVVDMREELRSGNRSMFSRRLLDE
LRRRLERGEQAVLLLNRRGYSTFVMCRSCGYVIRCPHCDISLTYHRAGERMKCHYCGHEE
PLVPRCPSCGSEHIRFFGTGTQKVEEELTRLLPKARVIRMDVDTTGRKGAHEELLSRFAA
KEADILLGTQMIAKGLDFPNVTLVGVLAADTMLHLPDFRAAEKTFQLLTQVSGRAGRHEL
PGEVIIQTYTPDHYSIELAARHDYRAFYQREMALRKAHGYPPYYYLTLITAAHEEAPAAA
KAAEKIAAYLRKHLSHEAVVLGPVASPIARLHDRYRYQCMIKYKREPNLTAALKAVIDRY
QADAAHGGVTITVDTNPYMMM
Download sequence
Identical sequences A0A063YSL9 A0A1D7NA16 A0A1V9C0Q7 A0A2H5KFH0 G8N163 Q5L0S5 T0QAM3 V6VDL0
WP_011230670.1.100150 WP_011230670.1.19233 WP_011230670.1.2219 WP_011230670.1.25743 WP_011230670.1.6497 WP_011230670.1.70239 WP_011230670.1.78869 WP_011230670.1.8599 WP_011230670.1.91533 WP_011230670.1.93593 gi|375008138|ref|YP_004981771.1| 235909.GK1170 NYSGXRC-10456f gi|56419705|ref|YP_147023.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]