SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5L223 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5L223
Domain Number 1 Region: 3-204
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.9e-38
Family ABC transporter ATPase domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5L223
Sequence length 216
Comment (tr|Q5L223|Q5L223_GEOKA) ABC transporter (ATP-binding protein) {ECO:0000313|EMBL:BAD75007.1} KW=Complete proteome; Reference proteome OX=235909 OS=Geobacillus kaustophilus (strain HTA426). GN=GK0722 OC=Geobacillus thermoleovorans group.
Sequence
MEPLFSLQNLTYRYDGGATIFQQFSFSIFSGETVLLTGPNGVGKTTLLHIISGLLDKGEL
HYQAFYKGNPIQLPDMRAHLSYVTSETVMFSKLTGYENIECFRLLWKLDQQYVRKANELC
SLLGMEEMLPLPVDQYSLGTKQKLHIAIALARPVELYLMDEPFNSLDRLSRDRLAEWIQG
DRQHAYLIASHVHQERFPGSRIISLTRPNNEDKIEK
Download sequence
Identical sequences A0A0K1KD64 A0A164G340 A0A1C3D662 A0A1V9C940 A0A2H5KGK1 L7ZVT4 Q5L223
235909.GK0722 gi|56419257|ref|YP_146575.1| gi|448236902|ref|YP_007400960.1| WP_011230225.1.17728 WP_011230225.1.20723 WP_011230225.1.2219 WP_011230225.1.22479 WP_011230225.1.38928 WP_011230225.1.56669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]