SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5L264 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5L264
Domain Number 1 Region: 295-752
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.81e-60
Family Tandem AAA-ATPase domain 0.019
Further Details:      
 
Domain Number 2 Region: 5-234
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000168
Family Tandem AAA-ATPase domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5L264
Sequence length 1167
Comment (sp|Q5L264|ADDB_GEOKA) ATP-dependent helicase/nuclease AddB {ECO:0000255|HAMAP-Rule:MF_01452} KW=Complete proteome; Reference proteome OX=235909 OS=Geobacillus kaustophilus (strain HTA426). GN=addB OC=Geobacillus thermoleovorans group.
Sequence
MSLRFLLGRSGSGKTAVCLEEIRRQLQEDPKGRAIVYLVPEQMTFQCEYALIHTEGVGGM
IRAQVFSFTRLAWRVLQETGGMTRYHIHDVGVQMMIRKIIEQRKQELKLFGRAADKHGFI
EQLNEMITECKRYCLTPGELRRHAKAFEDGPDQPGRRLLADKLSDVALVYEELERSLIGH
YLDSEDYLRLLAEHIPRSSYLRDADIYIDGFHHFAPQEYMIIEQLLRHCRRVTVCLTIDR
PYDDGMPDELHLFYLPAQTYRQLRELALSNDIAIEEPIVLSANRRHEDRALVHLEAQFHR
RPLLPYGAKTDAVHLYEASNRRAEIEAVAREIIRLVRDEGARYRDIALIIRQTEAYRDLV
KTVFFDFGIPYFMDEKEPMHHHPLIELVRAALETVVTRWRYEAVFRAVKTDLLFPTDGDL
HMWREAADKLENYVLAYGIKGDKWTNNERWAYRRYQALDGLNVPQTDEERQFEDMLNEWR
EALAAPLRRLERRLRRAEDGRGFCMALYLFLEELQIPKKLEKMSAQAEADGRLVEARQHE
QAWNAVVDLLDQYVEMLGTESLPLAEFVKIIEAGLDRLEFSLVPPAMDQVIVAQLDRSRL
IDIKYAFVIGANDGVIPAKVKEDGLMAEVEREQLRELGVALAPGGREQLFYDPFFVYLAL
VCPSRRLYVTYPLADGEGKALMPSPLIKQLTELFPHAPVHLCGNDPFDAPAEKAEAFVTA
PRATQTYLISQLRAWKRNYGIDPLWWDVYNTFIGHRDWKEQVRHAVSALFYTNGATPLKK
QWSQRLYGKKIQASVSRMEQFQKCPYAHFASHGLRLKERNVFRLEAPDVGQLFHAAIKQI
ADRLREQHLDWRELSRPDCERLSAEAVERIAPLIQQQVLSSSHRYEYMKRKLKHVVARTT
HVLSEHARASGFVPIGLELSFGPNGDLPPLRFRLPDGTVMELVGRIDRVDKAESSQGVLL
RIIDYKSSAKTLDLTEVYYGLALQMLTYLDIVLTYAEQLVGQPALPAGVLYFHIHNPIVQ
AKQWVDDEVEMAKKLLEPFRMRGLLLADVEAIRLMDGRTEDGQWSLIVPAQLTKSGSIHS
RSSVASPSDFAALRQHVRRLFIDIGGQIADGVVSIAPYKLKDKTACEFCVFKPVCQFDEA
LSGNEYRKLAPQTKEAVIEKLAEGKEG
Download sequence
Identical sequences Q5L264
gi|56419216|ref|YP_146534.1| 235909.GK0681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]