SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5L392 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5L392
Domain Number 1 Region: 354-591
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.06e-67
Family ABC transporter ATPase domain-like 0.000018
Further Details:      
 
Domain Number 2 Region: 26-319
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 1.7e-28
Family ABC transporter transmembrane region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5L392
Sequence length 609
Comment (tr|Q5L392|Q5L392_GEOKA) Lantibiotic ABC transporter (ATP-binding protein) {ECO:0000313|EMBL:BAD74588.1} KW=Complete proteome; Reference proteome OX=235909 OS=Geobacillus kaustophilus (strain HTA426). GN=GK0303 OC=Geobacillus thermoleovorans group.
Sequence
MNIKEYDDHVTIKDIVKSIRIVPKTLVLIKNVDKQSFFIIIFLSLLMGGAPIVTLLGSQN
LLNAIGSQNIHIIISALIFYISAVLLSEIISSFMEYYQNKFQTLINYKLNLQIMDKCTRL
SLQHFEDAEVYDMLQRVQNETPYKPFEVFLSILGAISAIVTFFSSMMILIHWKPWVLIIL
IFIPLVFSFYFFKIGQREFNVSWLRAPEKRKSWYLSYLMTRDNTFKEVKIYNLAGYILNK
FKEINKTFVEQDIHLFKRRTVFTFIFELVEQICINTVLVIIIISALAGEILIGHVVGLIQ
ALNLISSNSKKILNIIHSLYKNNLYINQLFEFLGLDEEVLDKGDRFVSGIDKIENIKIRN
LTFRYPTKPKVVLKNINLDINKGERIAIVGANGSGKSTLIKLLLKLYEHDEDSIFYNGVS
INDLDTEQLRKNIAVLFQDFVKYELKLTENVGFGDITRIDRDGELKQAMERARVNFIEDL
DTQLGLWFVDGVQLSGGQWQKVAIARALFRDASVYILDEPSSALDPISEKEVIDMFINMT
KDKIGIFISHRLSTAKLADKIVVMNDGEIVGIGTHWELLATNELYRRMYELEALKNEEEY
EHLNESAGL
Download sequence
Identical sequences Q5L392
WP_011229812.1.2219 gi|56418838|ref|YP_146156.1| 235909.GK0303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]