SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5L7P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5L7P0
Domain Number 1 Region: 239-496
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.94e-54
Family Pyruvate oxidase and decarboxylase Pyr module 0.045
Further Details:      
 
Domain Number 2 Region: 15-227
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.66e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.024
Further Details:      
 
Domain Number 3 Region: 507-615
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.42e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5L7P0
Sequence length 616
Comment (tr|Q5L7P0|Q5L7P0_BACFN) Putative 2-oxoglutarate ferredoxin oxidoreductase subunit {ECO:0000313|EMBL:CAH09910.1} KW=Complete proteome; Reference proteome OX=272559 OS=NCTC 9343). GN=BF9343_4129 OC=Bacteroides.
Sequence
MADEMMVKELEEVVVRFSGDSGDGMQLAGNIFSNVSATVGNDICTFPDYPADIRAPQGSL
TGVSGFQVHVGASKIFTPGDHCHVLVAMNPAALKTQIKFCKPQGLVITDSDSFGEKDLEK
AQFKTGNPFEEMGITQQVLEVPISSMCKESLKNSGLDNKAMLRCKNMFALGLVCWLFNRN
LSAAEKMLNEKFAKKPEIAAANIKVLNDGYNYGANTHASTSTYKIESKTPKAAGLYTDIN
GNKATSYGLIAAAEKAGLELYLGSYPITPATDILHELAKHKSLGVKTVQCEDEIAGCASA
VGAAFAGDLAVTTTSGPGVCLKSEAMNLAVIAELPLVVVNVQRGGPSTGMPTKSEQTDLL
QALYGRNGESPMPVIAATSPTNCFDAAYMAAKIALEHMTPVVLLTDAFIANGSAAWKLPN
MDEYPAINPPYVTPDMIGTWTPFQRNEKTGVRYWAVPGTEGFMHRIGGLEKSSETGVIST
EPENHQKMTLLRQAKVDKIADSIPEQEVQGDADADLLVVGWGGTYGHLYSAVEHMRKNGK
KVALAHFQYINPLPKNTAEILKKYKKIVVAEQNLGQFAGYLRMKVPGLNISQFNQVKGQP
FVTRELVEAFTKLLEE
Download sequence
Identical sequences A0A139SYS8 A0A149MU81 Q5L7P0
WP_010993775.1.37988 WP_010993775.1.58084 WP_010993775.1.6251 WP_010993775.1.95750 272559.BF4239 APC66685.0 gi|60683657|ref|YP_213801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]