SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5M9G0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5M9G0
Domain Number 1 Region: 17-156
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 6.66e-36
Family Deoxycytidylate deaminase-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5M9G0
Sequence length 178
Comment (sp|Q5M9G0|DCTD_RAT) dCMP deaminase KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Dctd; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MSDISCKKRDDYLEWPEYFMAVAFLSAQRSKDPSSQVGACIVNTENKIVGIGYNGMPNGC
SDDLLPWRRTAENKLDTKYPYVCHAELNAIMNKNSADVKGCSMYVALFPCNECAKLIIQA
GIKEVIFMSDKYHDSEETTAARLLFKLAGVTFRKFTPKYSKIVIDFDSINSRPSQKPQ
Download sequence
Identical sequences Q5M9G0 Q8K2D6
ENSRNOP00000017670 10090.ENSMUSP00000033966 10116.ENSRNOP00000017670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]