SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5T276 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5T276
Domain Number 1 Region: 7-184
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.55e-46
Family AAT-like 0.0000000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5T276
Sequence length 184
Comment (tr|Q5T276|Q5T276_HUMAN) Kynurenine--oxoglutarate transaminase 1 {ECO:0000313|Ensembl:ENSP00000412402} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KYAT1 OC=Catarrhini; Hominidae; Homo.
Sequence
MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFML
NQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVII
IEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVL
NTPN
Download sequence
Identical sequences Q5T276
ENSP00000412402 ENSP00000412402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]