SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5T418 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5T418
Domain Number 1 Region: 13-155
Classification Level Classification E-value
Superfamily DNA-glycosylase 7.54e-44
Family Mismatch glycosylase 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5T418
Sequence length 215
Comment (tr|Q5T418|Q5T418_HUMAN) Adenine DNA glycosylase {ECO:0000313|Ensembl:ENSP00000410263} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MUTYH OC=Catarrhini; Hominidae; Homo.
Sequence
MTPLVSRLSRLWEVNQLWAGLGYYSRGRRLQEGARKVVEELGGHMPRTAETLQQLLPGVG
RYTAGAIASIAFGQATGVVDGNVARVLCRVRAIGADPSSTLVSQQLWGLAQQLVDPARPG
DFNQAAMELGATVCTPQRPLCSQCPVESLCRARQRVEQEQLLASGSLSGSPDVEECAPNT
GQCHLCLPPSEPWDQTLGVVNFPRKASRKPPREES
Download sequence
Identical sequences Q5T418
ENSP00000410263 ENSP00000410263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]