SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5VU10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5VU10
Domain Number 1 Region: 23-173
Classification Level Classification E-value
Superfamily PHP domain-like 1.57e-31
Family RNase P subunit p30 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5VU10
Sequence length 212
Comment (tr|Q5VU10|Q5VU10_HUMAN) Ribonuclease P protein subunit p30 {ECO:0000313|Ensembl:ENSP00000407972} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RPP30 OC=Catarrhini; Hominidae; Homo.
Sequence
EIEKPVAVSELFTTLPIVQGKSRPIKILTRLTIIVSDPSHCNVLRATSSRARLYDVVAVF
PKTEKLFHIACTHLDVDLVCITVTEKLPFYFKRPPINVAIDRGLAFELVYSPAIKDSTMR
RYTISSALNLMQICKGKPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRK
TAFGIISTVKKPRPSEGDEDCLPASKKAKCEG
Download sequence
Identical sequences Q5VU10
ENSP00000407972 ENSP00000407972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]