SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5XI27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5XI27
Domain Number 1 Region: 104-505
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.66e-78
Family GABA-aminotransferase-like 0.0000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5XI27
Sequence length 523
Comment (tr|Q5XI27|Q5XI27_RAT) Accs protein {ECO:0000313|EMBL:AAH83866.1} OX=10116 OS=Rattus norvegicus (Rat). GN=RGD1309314_predicted OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
LQTLWFRKTRAGPADHSVLVASFGLIFCLPQKDSTVPTTCTGSASTQDMESGYGDDLQGE
CLRKPDQKQPKLYGVGDPTATFSSDSFCLSSRGRVIKWFWDSAEEGYRTYHMDEYDEDKN
PSGIINLGTSENKLCFDLLSWRLTQNDMLHVEPSLLQYPDWRGHRFLRKEVARFLSFYCK
SPAPLKPENVVVLNGCASLFSALATVLCEPGEVLLIPTPYYGAITQHIYLYGNIRLAYVY
LDSKVTGLNTRPFQLTVEKLEMALQGVNSEGVKVKGLILINPQNPLGDIYSPEELQDFLG
FAMRHKLHVIMDEVYMLSVFEESLGYRSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGV
LYTENQHVATAVASLCRYHGLSGLVQHQMAQLLQDHDWISQVYLPENHARLKAAHTYVSE
ELRALGIPFVSRGAGFFIWVDLRKYLREGTFEEEAMLWRRFLDNKVLLSSGKTFECKEPG
WFRVVFSDKENRLRLGMQRMRQVLKGQSQMVEDASRCHTQELQ
Download sequence
Identical sequences Q5XI27
ENSRNOP00000012214 10116.ENSRNOP00000012214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]